Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-SOX13 Mouse Monoclonal Antibody [clone: 3E8]

Toimittaja: US Biological
Type: Primary
Antigen: SOX13 (SRY (sex determining region Y)-box 13)
Clonality: monoclonal
Clone: 300000000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
100 µg 100 µG USBI133716
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigen symbol SOX13
Antigeenin nimi SRY (sex determining region Y)-box 13
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Monoclonal
Vasta-aineen tyyppi Primary
Clone 3E8
Host Mouse
Isotype IgG1 kappa
Western blot Yes
ELISA Yes
Amino acid number 25 to 138
Puhdistus purified by Protein A chromatography
Sekvenssi KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDV
Form liquid
Säilytyspuskuri PBS, pH 7,2.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm