Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-SP140 Mouse Monoclonal Antibody [clone: 3F9]

Toimittaja: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SP140 (SP140 nuclear body protein)
Clonality: monoclonal
Clone: 3F9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
100 µg 100 µG USBI133734
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigeenin symboli SP140
Antigeenin nimi SP140 nuclear body Protein
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Monoclonal
Vasta-aineen tyyppi Primary
Clone 3F9
Isäntä Mouse
Vasta-aineen isotyyppi IgG2a kappa
ELISA Yes
Amino acid number 504 to 613
Puhdistus purified by Protein A chromatography
Sekvenssi GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV*
Form liquid
Säilytyspuskuri PBS, pH 7,2.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm
 

Uusi ilme ja uudistettu sitoutuminen

Perustuu tuntemiisi ominaisuuksiin ja resursseihin, optimoitu Avantorin innovaation avulla®. Uusi brändimme symboloi ketteryyttä ja kykyämme mukautua asiakkaiden tarpeisiin.

LUE LISÄÄ ALOITA OSTOKSET