Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-SPA17 Mouse Polyclonal Antibody

Toimittaja: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml; Immunochemistry: 3μg/ml

Type: Primary
Antigen: SPA17 (sperm autoantigenic protein 17)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
50 µg 50 µG USBI133738
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigen symbol SPA17
Antigeenin nimi sperm autoantigenic Protein 17
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Polyclonal
Vasta-aineen tyyppi Primary
Host Mouse
Isotype IgG
Western blot Yes
ImmunoFluorescence Yes
Amino acid number 1 to 151
Puhdistus purified by Protein A chromatography
Sekvenssi MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Form liquid
Säilytyspuskuri PBS, pH 7,2.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm