Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-SPG21 Mouse Monoclonal Antibody [clone: 2B11]

Toimittaja: US Biological
Type: Primary
Antigen: SPG21 (spastic paraplegia 21 (autosomal recessive, Mast syndrome))
Clonality: monoclonal
Clone: 2B11
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
100 µg 100 µG USBI133761
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigen symbol SPG21
Antigeenin nimi spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Monoclonal
Vasta-aineen tyyppi Primary
Clone 2B11
Host Mouse
Isotype IgG2a kappa
ELISA Yes
Amino acid number 211 to 307
Puhdistus purified by Protein A chromatography
Sekvenssi PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Form liquid
Säilytyspuskuri PBS, pH 7,2.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm