Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-EPPIN Mouse Monoclonal Antibody [clone: 4G3]

Toimittaja: US Biological
Type: Primary
Antigen: EPPIN (epididymal peptidase inhibitor)
Clonality: monoclonal
Clone: 4G3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgM Kappa
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
200 µl 200 µl USBI133775
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigeenin symboli EPPIN
Antigeenin nimi Epididymal peptidase inhibitor
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Monoclonal
Vasta-aineen tyyppi Primary
Clone 4G3
Isäntä Mouse
Vasta-aineen isotyyppi IgM kappa
Western blot Yes
ELISA Yes
Amino acid number 22 to 134
Muoto ascites
Sekvenssi PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Form liquid
Säilytyspuskuri ascites fluid.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm