Jatka istuntoa?
Jäljellä 
Tämä istunto vanhenee
Istuntosi on vanhentunut. Kirjasimme sinut ulos turvallisuussyistä.
Haluatko kirjautua uudelleen sisään?

Anti-SPIRE1 Mouse Monoclonal Antibody [clone: 4C5]

Toimittaja: US Biological
Type: Primary
Antigen: SPIRE1 (spire-type actin nucleation factor 1)
Clonality: monoclonal
Clone: 4C5
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

TILAUS

Laajenna kaikki / Pienennä kaikki
Pistosyvyys Pak. VWR-tuoteluettelon nro Määrä
100 µg 100 µG USBI133778
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

TEKNISET TIEDOT

Antigeenin symboli SPIRE1
Antigeenin nimi spire-type actin nucleation factor 1
Reaktiivisuus Human
Konjugaatio Unconjugated
Klonaalisuus Monoclonal
Vasta-aineen tyyppi Primary
Clone 4C5
Isäntä Mouse
Vasta-aineen isotyyppi IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 482 to 584
Puhdistus purified by Protein A chromatography
Sekvenssi AASSequence:SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
Form liquid
Säilytyspuskuri PBS, pH 7,2.
Säilytyslämpötila Cool
Kuljetuslämpötila Ice
Syötä tarkemmat tiedot.

Valitse tuote johon etsit Sertifikaattia.

Ilmoita eränumero. Tämä kenttä on pakollinen. Jos et tiedä VWR Chemicalsin eränumeroa syötä "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

tai
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Kuvaus Tuoteluettelon nro Availability Tuote Sinun hintasi Price Per lkm